Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 848958..849583 | Replicon | chromosome |
| Accession | NZ_CP117382 | ||
| Organism | Salmonella enterica subsp. enterica serovar Uganda strain RM018 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PQP98_RS04170 | Protein ID | WP_000911337.1 |
| Coordinates | 849185..849583 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | PQP98_RS04165 | Protein ID | WP_000557545.1 |
| Coordinates | 848958..849185 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP98_RS04135 (844054) | 844054..845152 | + | 1099 | WP_274877756.1 | peptide chain release factor 2 | - |
| PQP98_RS04140 (845162) | 845162..846679 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| PQP98_RS04145 (846755) | 846755..847300 | - | 546 | WP_050067887.1 | isopentenyl-diphosphate Delta-isomerase | - |
| PQP98_RS04150 (847565) | 847565..848323 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
| PQP98_RS04160 (848569) | 848569..848781 | - | 213 | WP_024152440.1 | hypothetical protein | - |
| PQP98_RS04165 (848958) | 848958..849185 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PQP98_RS04170 (849185) | 849185..849583 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PQP98_RS04175 (850392) | 850392..850928 | + | 537 | WP_001038503.1 | STM3031 family outer membrane protein | - |
| PQP98_RS04180 (850975) | 850975..851607 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| PQP98_RS04185 (852326) | 852326..852913 | + | 588 | WP_001244643.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 848958..858731 | 9773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T270972 WP_000911337.1 NZ_CP117382:849185-849583 [Salmonella enterica subsp. enterica serovar Uganda]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|