Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4299769..4300550 | Replicon | chromosome |
Accession | NZ_CP117380 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM037 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | PQP93_RS21110 | Protein ID | WP_000625912.1 |
Coordinates | 4299769..4300260 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | PQP93_RS21115 | Protein ID | WP_001110450.1 |
Coordinates | 4300257..4300550 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP93_RS21080 (4296030) | 4296030..4296527 | - | 498 | WP_001670425.1 | FimD/PapC N-terminal domain-containing protein | - |
PQP93_RS21085 (4296651) | 4296651..4297481 | - | 831 | WP_001180236.1 | fimbria/pilus periplasmic chaperone | - |
PQP93_RS21090 (4297683) | 4297683..4297988 | - | 306 | WP_000370555.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PQP93_RS21095 (4298519) | 4298519..4298662 | + | 144 | Protein_4124 | transposase | - |
PQP93_RS21100 (4298679) | 4298679..4299025 | + | 347 | Protein_4125 | Rpn family recombination-promoting nuclease/putative transposase | - |
PQP93_RS21105 (4299306) | 4299306..4299554 | - | 249 | Protein_4126 | IS481 family transposase | - |
PQP93_RS21110 (4299769) | 4299769..4300260 | - | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
PQP93_RS21115 (4300257) | 4300257..4300550 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
PQP93_RS21120 (4300867) | 4300867..4301089 | + | 223 | Protein_4129 | hypothetical protein | - |
PQP93_RS21125 (4301353) | 4301353..4302228 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
PQP93_RS21130 (4302225) | 4302225..4302512 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQP93_RS21135 (4302505) | 4302505..4302687 | - | 183 | WP_001670702.1 | ATP-binding cassette domain-containing protein | - |
PQP93_RS21140 (4302707) | 4302707..4302806 | + | 100 | Protein_4133 | hypothetical protein | - |
PQP93_RS21145 (4302804) | 4302804..4303049 | + | 246 | Protein_4134 | hypothetical protein | - |
PQP93_RS21150 (4303343) | 4303343..4304248 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4292858..4302512 | 9654 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T270967 WP_000625912.1 NZ_CP117380:c4300260-4299769 [Salmonella enterica subsp. enterica serovar Newport]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10949.56 Da Isoelectric Point: 8.6141
>AT270967 WP_001110450.1 NZ_CP117380:c4300550-4300257 [Salmonella enterica subsp. enterica serovar Newport]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |