Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4182587..4183103 | Replicon | chromosome |
Accession | NZ_CP117380 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM037 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0R9NWE9 |
Locus tag | PQP93_RS20465 | Protein ID | WP_000220579.1 |
Coordinates | 4182587..4182871 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PQP93_RS20470 | Protein ID | WP_000212724.1 |
Coordinates | 4182861..4183103 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP93_RS20450 (4177703) | 4177703..4179355 | + | 1653 | WP_000155055.1 | alpha,alpha-phosphotrehalase | - |
PQP93_RS20455 (4179764) | 4179764..4181902 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQP93_RS20460 (4182119) | 4182119..4182583 | + | 465 | WP_001009175.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQP93_RS20465 (4182587) | 4182587..4182871 | - | 285 | WP_000220579.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQP93_RS20470 (4182861) | 4182861..4183103 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQP93_RS20475 (4183181) | 4183181..4185094 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
PQP93_RS20480 (4185111) | 4185111..4185851 | - | 741 | WP_000779247.1 | KDGP aldolase family protein | - |
PQP93_RS20485 (4185848) | 4185848..4186966 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQP93_RS20490 (4186950) | 4186950..4188083 | - | 1134 | WP_000459949.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10884.70 Da Isoelectric Point: 10.0482
>T270966 WP_000220579.1 NZ_CP117380:c4182871-4182587 [Salmonella enterica subsp. enterica serovar Newport]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NWE9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |