Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3492775..3493395 | Replicon | chromosome |
Accession | NZ_CP117380 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM037 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP93_RS17290 | Protein ID | WP_001280991.1 |
Coordinates | 3493177..3493395 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP93_RS17285 | Protein ID | WP_000344807.1 |
Coordinates | 3492775..3493149 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP93_RS17275 (3487914) | 3487914..3489107 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP93_RS17280 (3489130) | 3489130..3492279 | + | 3150 | WP_274890115.1 | efflux RND transporter permease AcrB | - |
PQP93_RS17285 (3492775) | 3492775..3493149 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP93_RS17290 (3493177) | 3493177..3493395 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP93_RS17295 (3493574) | 3493574..3494125 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQP93_RS17300 (3494242) | 3494242..3494712 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQP93_RS17305 (3494768) | 3494768..3494908 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP93_RS17310 (3494914) | 3494914..3495174 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP93_RS17315 (3495399) | 3495399..3496949 | + | 1551 | WP_274890116.1 | EAL domain-containing protein | - |
PQP93_RS17325 (3497180) | 3497180..3497569 | + | 390 | WP_000961287.1 | MGMT family protein | - |
PQP93_RS17330 (3497602) | 3497602..3498171 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270963 WP_001280991.1 NZ_CP117380:3493177-3493395 [Salmonella enterica subsp. enterica serovar Newport]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270963 WP_000344807.1 NZ_CP117380:3492775-3493149 [Salmonella enterica subsp. enterica serovar Newport]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|