Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 992606..993420 | Replicon | chromosome |
Accession | NZ_CP117380 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM037 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | PQP93_RS04735 | Protein ID | WP_000971655.1 |
Coordinates | 992606..993133 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | PQP93_RS04740 | Protein ID | WP_000855694.1 |
Coordinates | 993130..993420 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP93_RS04705 (988888) | 988888..989286 | + | 399 | Protein_921 | cytoplasmic protein | - |
PQP93_RS04710 (989477) | 989477..989716 | + | 240 | Protein_922 | hypothetical protein | - |
PQP93_RS04715 (989873) | 989873..990541 | + | 669 | WP_000445914.1 | hypothetical protein | - |
PQP93_RS04720 (990568) | 990568..991062 | + | 495 | WP_000424948.1 | hypothetical protein | - |
PQP93_RS04725 (991234) | 991234..991890 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
PQP93_RS04730 (992123) | 992123..992533 | + | 411 | Protein_926 | transposase | - |
PQP93_RS04735 (992606) | 992606..993133 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
PQP93_RS04740 (993130) | 993130..993420 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
PQP93_RS04745 (993690) | 993690..993868 | - | 179 | Protein_929 | IS3 family transposase | - |
PQP93_RS04750 (994109) | 994109..994435 | + | 327 | WP_000393302.1 | hypothetical protein | - |
PQP93_RS04755 (994708) | 994708..995055 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
PQP93_RS04760 (995040) | 995040..995489 | - | 450 | WP_000381610.1 | membrane protein | - |
PQP93_RS04765 (995921) | 995921..996364 | - | 444 | WP_000715099.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PQP93_RS04770 (996820) | 996820..997470 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 992309..992533 | 224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T270958 WP_000971655.1 NZ_CP117380:c993133-992606 [Salmonella enterica subsp. enterica serovar Newport]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT270958 WP_000855694.1 NZ_CP117380:c993420-993130 [Salmonella enterica subsp. enterica serovar Newport]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |