Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 836278..836903 | Replicon | chromosome |
Accession | NZ_CP117380 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM037 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PQP93_RS04040 | Protein ID | WP_000911337.1 |
Coordinates | 836505..836903 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | PQP93_RS04035 | Protein ID | WP_000557545.1 |
Coordinates | 836278..836505 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP93_RS04005 (831323) | 831323..832840 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQP93_RS04010 (832916) | 832916..833461 | - | 546 | WP_000133986.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQP93_RS04015 (833726) | 833726..834484 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
PQP93_RS04025 (834769) | 834769..835575 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
PQP93_RS04030 (835850) | 835850..836101 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PQP93_RS04035 (836278) | 836278..836505 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQP93_RS04040 (836505) | 836505..836903 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQP93_RS04045 (837711) | 837711..838247 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
PQP93_RS04050 (838294) | 838294..838926 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQP93_RS04055 (839645) | 839645..840226 | + | 582 | WP_001244652.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 835850..844689 | 8839 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T270957 WP_000911337.1 NZ_CP117380:836505-836903 [Salmonella enterica subsp. enterica serovar Newport]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|