Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4293099..4293880 | Replicon | chromosome |
Accession | NZ_CP117376 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM041 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A0R9NZI3 |
Locus tag | PQQ16_RS21045 | Protein ID | WP_000625912.1 |
Coordinates | 4293099..4293590 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | M7RNV8 |
Locus tag | PQQ16_RS21050 | Protein ID | WP_001110450.1 |
Coordinates | 4293587..4293880 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ16_RS21015 (4289360) | 4289360..4289857 | - | 498 | WP_001670425.1 | FimD/PapC N-terminal domain-containing protein | - |
PQQ16_RS21020 (4289981) | 4289981..4290811 | - | 831 | WP_001180236.1 | fimbria/pilus periplasmic chaperone | - |
PQQ16_RS21025 (4291013) | 4291013..4291318 | - | 306 | WP_000370555.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
PQQ16_RS21030 (4291849) | 4291849..4291992 | + | 144 | Protein_4111 | transposase | - |
PQQ16_RS21035 (4292009) | 4292009..4292355 | + | 347 | Protein_4112 | Rpn family recombination-promoting nuclease/putative transposase | - |
PQQ16_RS21040 (4292636) | 4292636..4292884 | - | 249 | Protein_4113 | IS481 family transposase | - |
PQQ16_RS21045 (4293099) | 4293099..4293590 | - | 492 | WP_000625912.1 | GNAT family N-acetyltransferase | Toxin |
PQQ16_RS21050 (4293587) | 4293587..4293880 | - | 294 | WP_001110450.1 | DUF1778 domain-containing protein | Antitoxin |
PQQ16_RS21055 (4294197) | 4294197..4294419 | + | 223 | Protein_4116 | hypothetical protein | - |
PQQ16_RS21060 (4294683) | 4294683..4295558 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
PQQ16_RS21065 (4295555) | 4295555..4295842 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQQ16_RS21070 (4295835) | 4295835..4296017 | - | 183 | WP_001670702.1 | ATP-binding cassette domain-containing protein | - |
PQQ16_RS21075 (4296037) | 4296037..4296136 | + | 100 | Protein_4120 | hypothetical protein | - |
PQQ16_RS21080 (4296134) | 4296134..4296382 | + | 249 | Protein_4121 | hypothetical protein | - |
PQQ16_RS21085 (4296677) | 4296677..4297582 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4286188..4295842 | 9654 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17606.43 Da Isoelectric Point: 7.7297
>T270936 WP_000625912.1 NZ_CP117376:c4293590-4293099 [Salmonella enterica subsp. enterica serovar Newport]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10949.56 Da Isoelectric Point: 8.6141
>AT270936 WP_001110450.1 NZ_CP117376:c4293880-4293587 [Salmonella enterica subsp. enterica serovar Newport]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9NZI3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R9PGG6 |