Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4175923..4176439 | Replicon | chromosome |
| Accession | NZ_CP117376 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain RM041 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0R9NWE9 |
| Locus tag | PQQ16_RS20400 | Protein ID | WP_000220579.1 |
| Coordinates | 4175923..4176207 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQQ16_RS20405 | Protein ID | WP_000212724.1 |
| Coordinates | 4176197..4176439 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ16_RS20385 (4171039) | 4171039..4172691 | + | 1653 | WP_000155055.1 | alpha,alpha-phosphotrehalase | - |
| PQQ16_RS20390 (4173100) | 4173100..4175238 | + | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQQ16_RS20395 (4175455) | 4175455..4175919 | + | 465 | WP_001009175.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQQ16_RS20400 (4175923) | 4175923..4176207 | - | 285 | WP_000220579.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ16_RS20405 (4176197) | 4176197..4176439 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQQ16_RS20410 (4176517) | 4176517..4178430 | - | 1914 | WP_001212131.1 | BglG family transcription antiterminator | - |
| PQQ16_RS20415 (4178447) | 4178447..4179187 | - | 741 | WP_000779247.1 | KDGP aldolase family protein | - |
| PQQ16_RS20420 (4179184) | 4179184..4180302 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQQ16_RS20425 (4180286) | 4180286..4181419 | - | 1134 | WP_000459949.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10884.70 Da Isoelectric Point: 10.0482
>T270935 WP_000220579.1 NZ_CP117376:c4176207-4175923 [Salmonella enterica subsp. enterica serovar Newport]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDTNKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0R9NWE9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |