Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3486113..3486733 | Replicon | chromosome |
Accession | NZ_CP117376 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM041 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ16_RS17230 | Protein ID | WP_001280991.1 |
Coordinates | 3486515..3486733 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQQ16_RS17225 | Protein ID | WP_000344807.1 |
Coordinates | 3486113..3486487 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ16_RS17215 (3481252) | 3481252..3482445 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ16_RS17220 (3482468) | 3482468..3485617 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQQ16_RS17225 (3486113) | 3486113..3486487 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ16_RS17230 (3486515) | 3486515..3486733 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ16_RS17235 (3486912) | 3486912..3487463 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQQ16_RS17240 (3487580) | 3487580..3488050 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQQ16_RS17245 (3488106) | 3488106..3488246 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ16_RS17250 (3488252) | 3488252..3488512 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ16_RS17255 (3488737) | 3488737..3490287 | + | 1551 | WP_000213138.1 | EAL domain-containing protein | - |
PQQ16_RS17265 (3490518) | 3490518..3490907 | + | 390 | WP_000961287.1 | MGMT family protein | - |
PQQ16_RS17270 (3490940) | 3490940..3491509 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270932 WP_001280991.1 NZ_CP117376:3486515-3486733 [Salmonella enterica subsp. enterica serovar Newport]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270932 WP_000344807.1 NZ_CP117376:3486113-3486487 [Salmonella enterica subsp. enterica serovar Newport]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|