Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 836289..836914 | Replicon | chromosome |
Accession | NZ_CP117376 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM041 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PQQ16_RS04035 | Protein ID | WP_000911337.1 |
Coordinates | 836516..836914 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | PQQ16_RS04030 | Protein ID | WP_000557545.1 |
Coordinates | 836289..836516 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ16_RS04000 (831334) | 831334..832851 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQQ16_RS04005 (832927) | 832927..833472 | - | 546 | WP_000133986.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQQ16_RS04010 (833737) | 833737..834495 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
PQQ16_RS04020 (834780) | 834780..835586 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
PQQ16_RS04025 (835861) | 835861..836112 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PQQ16_RS04030 (836289) | 836289..836516 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQQ16_RS04035 (836516) | 836516..836914 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQQ16_RS04040 (837722) | 837722..838258 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
PQQ16_RS04045 (838305) | 838305..838937 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQQ16_RS04050 (839656) | 839656..840237 | + | 582 | WP_001244652.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 835861..844697 | 8836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T270926 WP_000911337.1 NZ_CP117376:836516-836914 [Salmonella enterica subsp. enterica serovar Newport]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|