Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 41567..42089 Replicon plasmid pRM043_2
Accession NZ_CP117375
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM043

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQQ08_RS24740 Protein ID WP_000220560.1
Coordinates 41808..42089 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQQ08_RS24735 Protein ID WP_000121743.1
Coordinates 41567..41818 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ08_RS24710 (PQQ08_24710) 36978..37598 + 621 WP_000864788.1 ParA family protein -
PQQ08_RS24715 (PQQ08_24715) 37650..37880 + 231 WP_000051066.1 plasmid partition protein ParG -
PQQ08_RS24720 (PQQ08_24720) 38519..38872 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
PQQ08_RS24725 (PQQ08_24725) 39009..39455 - 447 WP_001074381.1 hypothetical protein -
PQQ08_RS24730 (PQQ08_24730) 39495..40331 - 837 WP_001575533.1 replication initiation protein -
PQQ08_RS24735 (PQQ08_24735) 41567..41818 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQQ08_RS24740 (PQQ08_24740) 41808..42089 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQQ08_RS24745 (PQQ08_24745) 42235..42558 + 324 WP_001181909.1 hypothetical protein -
PQQ08_RS24750 (PQQ08_24750) 42603..42848 + 246 WP_000356542.1 hypothetical protein -
PQQ08_RS24755 (PQQ08_24755) 42838..43053 + 216 WP_001180117.1 hypothetical protein -
PQQ08_RS24760 (PQQ08_24760) 43146..43475 + 330 WP_000866650.1 hypothetical protein -
PQQ08_RS24765 (PQQ08_24765) 43518..43697 + 180 WP_001575529.1 hypothetical protein -
PQQ08_RS24770 (PQQ08_24770) 43767..43916 + 150 WP_000003880.1 hypothetical protein -
PQQ08_RS24775 (PQQ08_24775) 43929..44201 + 273 WP_000160399.1 hypothetical protein -
PQQ08_RS24780 (PQQ08_24780) 44527..45072 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
PQQ08_RS24785 (PQQ08_24785) 45075..46256 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / fdeC / spvC / spvB 1..75389 75389


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T270923 WP_000220560.1 NZ_CP117375:41808-42089 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT270923 WP_000121743.1 NZ_CP117375:41567-41818 [Salmonella enterica subsp. enterica serovar Dublin]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References