Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 41567..42089 | Replicon | plasmid pRM043_2 |
| Accession | NZ_CP117375 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM043 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G3CAN5 |
| Locus tag | PQQ08_RS24740 | Protein ID | WP_000220560.1 |
| Coordinates | 41808..42089 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | PQQ08_RS24735 | Protein ID | WP_000121743.1 |
| Coordinates | 41567..41818 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ08_RS24710 (PQQ08_24710) | 36978..37598 | + | 621 | WP_000864788.1 | ParA family protein | - |
| PQQ08_RS24715 (PQQ08_24715) | 37650..37880 | + | 231 | WP_000051066.1 | plasmid partition protein ParG | - |
| PQQ08_RS24720 (PQQ08_24720) | 38519..38872 | - | 354 | WP_001675596.1 | DNA distortion polypeptide 3 | - |
| PQQ08_RS24725 (PQQ08_24725) | 39009..39455 | - | 447 | WP_001074381.1 | hypothetical protein | - |
| PQQ08_RS24730 (PQQ08_24730) | 39495..40331 | - | 837 | WP_001575533.1 | replication initiation protein | - |
| PQQ08_RS24735 (PQQ08_24735) | 41567..41818 | + | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| PQQ08_RS24740 (PQQ08_24740) | 41808..42089 | + | 282 | WP_000220560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ08_RS24745 (PQQ08_24745) | 42235..42558 | + | 324 | WP_001181909.1 | hypothetical protein | - |
| PQQ08_RS24750 (PQQ08_24750) | 42603..42848 | + | 246 | WP_000356542.1 | hypothetical protein | - |
| PQQ08_RS24755 (PQQ08_24755) | 42838..43053 | + | 216 | WP_001180117.1 | hypothetical protein | - |
| PQQ08_RS24760 (PQQ08_24760) | 43146..43475 | + | 330 | WP_000866650.1 | hypothetical protein | - |
| PQQ08_RS24765 (PQQ08_24765) | 43518..43697 | + | 180 | WP_001575529.1 | hypothetical protein | - |
| PQQ08_RS24770 (PQQ08_24770) | 43767..43916 | + | 150 | WP_000003880.1 | hypothetical protein | - |
| PQQ08_RS24775 (PQQ08_24775) | 43929..44201 | + | 273 | WP_000160399.1 | hypothetical protein | - |
| PQQ08_RS24780 (PQQ08_24780) | 44527..45072 | + | 546 | WP_000757691.1 | DNA distortion polypeptide 1 | - |
| PQQ08_RS24785 (PQQ08_24785) | 45075..46256 | + | 1182 | WP_000539536.1 | MobP1 family relaxase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | faeH / faeI / fdeC / spvC / spvB | 1..75389 | 75389 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11005.83 Da Isoelectric Point: 10.5938
>T270923 WP_000220560.1 NZ_CP117375:41808-42089 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G3CAN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I301 |