Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 13101..13626 Replicon plasmid pRM043_2
Accession NZ_CP117375
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM043

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag PQQ08_RS24565 Protein ID WP_001159863.1
Coordinates 13321..13626 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag PQQ08_RS24560 Protein ID WP_000813641.1
Coordinates 13101..13319 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ08_RS24525 (PQQ08_24525) 8128..8841 + 714 WP_000801115.1 hypothetical protein -
PQQ08_RS24530 (PQQ08_24530) 8966..9550 + 585 WP_001575501.1 hypothetical protein -
PQQ08_RS24535 (PQQ08_24535) 9623..9835 + 213 WP_000063794.1 FaeA/PapI family transcriptional regulator -
PQQ08_RS24540 (PQQ08_24540) 10096..10257 + 162 WP_001816720.1 hypothetical protein -
PQQ08_RS24545 (PQQ08_24545) 10283..11131 + 849 WP_000175391.1 SdiA-regulated domain-containing protein -
PQQ08_RS24550 (PQQ08_24550) 11701..12129 - 429 WP_000812999.1 type II toxin-antitoxin system VapC family toxin -
PQQ08_RS24555 (PQQ08_24555) 12126..12356 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin -
PQQ08_RS24560 (PQQ08_24560) 13101..13319 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PQQ08_RS24565 (PQQ08_24565) 13321..13626 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
PQQ08_RS24570 (PQQ08_24570) 13628..13918 + 291 WP_001266176.1 hypothetical protein -
PQQ08_RS24575 (PQQ08_24575) 13915..14436 + 522 WP_000198608.1 hypothetical protein -
PQQ08_RS24580 (PQQ08_24580) 14471..15253 + 783 WP_000082169.1 site-specific integrase -
PQQ08_RS24585 (PQQ08_24585) 15262..15945 + 684 WP_001751692.1 EAL domain-containing protein -
PQQ08_RS24590 (PQQ08_24590) 15999..16487 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PQQ08_RS24595 (PQQ08_24595) 16481..16817 + 337 Protein_24 hypothetical protein -
PQQ08_RS24600 (PQQ08_24600) 17030..17590 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -
PQQ08_RS24605 (PQQ08_24605) 17657..18016 - 360 WP_001675600.1 helix-turn-helix domain-containing protein -
PQQ08_RS24610 (PQQ08_24610) 18073..18498 + 426 WP_000064919.1 IS200/IS605 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / fdeC / spvC / spvB 1..75389 75389


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T270922 WP_001159863.1 NZ_CP117375:13321-13626 [Salmonella enterica subsp. enterica serovar Dublin]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT270922 WP_000813641.1 NZ_CP117375:13101-13319 [Salmonella enterica subsp. enterica serovar Dublin]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References