Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4243868..4244384 | Replicon | chromosome |
Accession | NZ_CP117373 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM043 |
Toxin (Protein)
Gene name | relE | Uniprot ID | M7RIY5 |
Locus tag | PQQ08_RS20955 | Protein ID | WP_000220574.1 |
Coordinates | 4243868..4244152 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PQQ08_RS20960 | Protein ID | WP_000212724.1 |
Coordinates | 4244142..4244384 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ08_RS20940 (4238984) | 4238984..4240636 | + | 1653 | WP_001751520.1 | alpha,alpha-phosphotrehalase | - |
PQQ08_RS20945 (4241045) | 4241045..4243183 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PQQ08_RS20950 (4243400) | 4243400..4243864 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PQQ08_RS20955 (4243868) | 4243868..4244152 | - | 285 | WP_000220574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ08_RS20960 (4244142) | 4244142..4244384 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PQQ08_RS20965 (4244462) | 4244462..4246375 | - | 1914 | WP_001212138.1 | PRD domain-containing protein | - |
PQQ08_RS20970 (4246392) | 4246392..4247132 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
PQQ08_RS20975 (4247129) | 4247129..4248247 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PQQ08_RS20980 (4248231) | 4248231..4249364 | - | 1134 | WP_274896628.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10869.68 Da Isoelectric Point: 9.8739
>T270916 WP_000220574.1 NZ_CP117373:c4244152-4243868 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | M7RIY5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |