Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4201377..4201927 Replicon chromosome
Accession NZ_CP117373
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM043

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQQ08_RS20740 Protein ID WP_001199743.1
Coordinates 4201377..4201685 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PQQ08_RS20745 Protein ID WP_001118105.1
Coordinates 4201688..4201927 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ08_RS20720 (4197951) 4197951..4198691 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PQQ08_RS20725 (4198813) 4198813..4199343 - 531 WP_000909460.1 SEF14 fimbria major subunit SefA -
PQQ08_RS20730 (4199666) 4199666..4200799 + 1134 Protein_4058 IS3 family transposase -
PQQ08_RS20735 (4200831) 4200831..4200971 - 141 Protein_4059 Arm DNA-binding domain-containing protein -
PQQ08_RS20740 (4201377) 4201377..4201685 - 309 WP_001199743.1 CcdB family protein Toxin
PQQ08_RS20745 (4201688) 4201688..4201927 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQQ08_RS20750 (4202036) 4202036..4202284 - 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
PQQ08_RS20755 (4202475) 4202475..4202906 - 432 Protein_4063 helix-turn-helix domain-containing protein -
PQQ08_RS20765 (4203663) 4203663..4204682 + 1020 WP_274896626.1 NAD(P)-dependent alcohol dehydrogenase -
PQQ08_RS20770 (4204710) 4204710..4205240 - 531 WP_000896758.1 gluconokinase -
PQQ08_RS20775 (4205457) 4205457..4206488 + 1032 WP_000453348.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4199758..4202861 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270915 WP_001199743.1 NZ_CP117373:c4201685-4201377 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT270915 WP_001118105.1 NZ_CP117373:c4201927-4201688 [Salmonella enterica subsp. enterica serovar Dublin]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References