Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4151137..4151713 | Replicon | chromosome |
Accession | NZ_CP117373 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM043 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | PQQ08_RS20500 | Protein ID | WP_001131963.1 |
Coordinates | 4151426..4151713 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A5U1K3M6 |
Locus tag | PQQ08_RS20495 | Protein ID | WP_000063141.1 |
Coordinates | 4151137..4151439 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ08_RS20480 (4147647) | 4147647..4149797 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
PQQ08_RS20485 (4149892) | 4149892..4150095 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
PQQ08_RS20490 (4150106) | 4150106..4151062 | + | 957 | WP_000187843.1 | GTPase | - |
PQQ08_RS20495 (4151137) | 4151137..4151439 | - | 303 | WP_000063141.1 | BrnA antitoxin family protein | Antitoxin |
PQQ08_RS20500 (4151426) | 4151426..4151713 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
PQQ08_RS20505 (4152137) | 4152137..4153977 | + | 1841 | Protein_4013 | 3'-5' exonuclease | - |
PQQ08_RS20510 (4154587) | 4154587..4154919 | + | 333 | WP_274896624.1 | type I restriction endonuclease subunit M | - |
PQQ08_RS20515 (4154983) | 4154983..4155165 | + | 183 | WP_235005194.1 | hypothetical protein | - |
PQQ08_RS20520 (4155595) | 4155595..4156233 | + | 639 | WP_227468645.1 | N-6 DNA methylase | - |
PQQ08_RS20525 (4156455) | 4156455..4156589 | - | 135 | WP_001055725.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T270914 WP_001131963.1 NZ_CP117373:c4151713-4151426 [Salmonella enterica subsp. enterica serovar Dublin]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11431.99 Da Isoelectric Point: 9.8948
>AT270914 WP_000063141.1 NZ_CP117373:c4151439-4151137 [Salmonella enterica subsp. enterica serovar Dublin]
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRDKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRDKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|