Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3549823..3550443 | Replicon | chromosome |
Accession | NZ_CP117373 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM043 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ08_RS17720 | Protein ID | WP_001280991.1 |
Coordinates | 3550225..3550443 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQQ08_RS17715 | Protein ID | WP_000344807.1 |
Coordinates | 3549823..3550197 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ08_RS17705 (3544962) | 3544962..3546155 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ08_RS17710 (3546178) | 3546178..3549327 | + | 3150 | WP_052897443.1 | efflux RND transporter permease AcrB | - |
PQQ08_RS17715 (3549823) | 3549823..3550197 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ08_RS17720 (3550225) | 3550225..3550443 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ08_RS17725 (3550622) | 3550622..3551173 | + | 552 | WP_001278787.1 | maltose O-acetyltransferase | - |
PQQ08_RS17730 (3551291) | 3551291..3551761 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQQ08_RS17735 (3551817) | 3551817..3551957 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ08_RS17740 (3551963) | 3551963..3552223 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ08_RS17745 (3552448) | 3552448..3553998 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
PQQ08_RS17755 (3554229) | 3554229..3554618 | + | 390 | WP_000961287.1 | MGMT family protein | - |
PQQ08_RS17760 (3554651) | 3554651..3555220 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270911 WP_001280991.1 NZ_CP117373:3550225-3550443 [Salmonella enterica subsp. enterica serovar Dublin]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270911 WP_000344807.1 NZ_CP117373:3549823-3550197 [Salmonella enterica subsp. enterica serovar Dublin]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|