Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 4292831..4293612 Replicon chromosome
Accession NZ_CP117371
Organism Salmonella enterica subsp. enterica serovar Newport strain RM049

Toxin (Protein)


Gene name TacT2 Uniprot ID A0A0R9NZI3
Locus tag PQQ06_RS21060 Protein ID WP_000625912.1
Coordinates 4292831..4293322 (-) Length 164 a.a.

Antitoxin (Protein)


Gene name TacA2 Uniprot ID M7RNV8
Locus tag PQQ06_RS21065 Protein ID WP_001110450.1
Coordinates 4293319..4293612 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ06_RS21030 (4289092) 4289092..4289589 - 498 WP_001670425.1 FimD/PapC N-terminal domain-containing protein -
PQQ06_RS21035 (4289713) 4289713..4290543 - 831 WP_001180236.1 fimbria/pilus periplasmic chaperone -
PQQ06_RS21040 (4290745) 4290745..4291050 - 306 WP_000370555.1 PapB/FocB family fimbrial expression transcriptional regulator -
PQQ06_RS21045 (4291581) 4291581..4291724 + 144 Protein_4114 transposase -
PQQ06_RS21050 (4291741) 4291741..4292087 + 347 Protein_4115 Rpn family recombination-promoting nuclease/putative transposase -
PQQ06_RS21055 (4292368) 4292368..4292616 - 249 Protein_4116 IS481 family transposase -
PQQ06_RS21060 (4292831) 4292831..4293322 - 492 WP_000625912.1 GNAT family N-acetyltransferase Toxin
PQQ06_RS21065 (4293319) 4293319..4293612 - 294 WP_001110450.1 DUF1778 domain-containing protein Antitoxin
PQQ06_RS21070 (4293974) 4293974..4294574 + 601 Protein_4119 solute carrier family 23 protein -
PQQ06_RS21075 (4294572) 4294572..4295324 + 753 WP_274898591.1 AraC family transcriptional regulator -
PQQ06_RS21080 (4295321) 4295321..4295607 + 287 Protein_4121 transcriptional regulator RtsB -
PQQ06_RS21085 (4295600) 4295600..4295782 - 183 WP_001670702.1 ATP-binding cassette domain-containing protein -
PQQ06_RS21090 (4295802) 4295802..4295901 + 100 Protein_4123 hypothetical protein -
PQQ06_RS21095 (4295899) 4295899..4296144 + 246 Protein_4124 hypothetical protein -
PQQ06_RS21100 (4296438) 4296438..4297343 - 906 WP_001268200.1 YjiK family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4285920..4295324 9404
- inside Genomic island - - 4285920..4296048 10128


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(87-144)

Antitoxin

Vibrio phage ICP1, Orf50

(14-88)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17606.43 Da        Isoelectric Point: 7.7297

>T270897 WP_000625912.1 NZ_CP117371:c4293322-4292831 [Salmonella enterica subsp. enterica serovar Newport]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSSVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV

Download         Length: 492 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 10949.56 Da        Isoelectric Point: 8.6141

>AT270897 WP_001110450.1 NZ_CP117371:c4293612-4293319 [Salmonella enterica subsp. enterica serovar Newport]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0R9NZI3

Antitoxin

Source ID Structure
AlphaFold DB A0A0R9PGG6

References