Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3485865..3486485 | Replicon | chromosome |
| Accession | NZ_CP117371 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newport strain RM049 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQQ06_RS17245 | Protein ID | WP_001280991.1 |
| Coordinates | 3486267..3486485 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PQQ06_RS17240 | Protein ID | WP_000344807.1 |
| Coordinates | 3485865..3486239 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ06_RS17230 (3481004) | 3481004..3482197 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQQ06_RS17235 (3482220) | 3482220..3485369 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| PQQ06_RS17240 (3485865) | 3485865..3486239 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PQQ06_RS17245 (3486267) | 3486267..3486485 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQQ06_RS17250 (3486664) | 3486664..3487215 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
| PQQ06_RS17255 (3487332) | 3487332..3487802 | + | 471 | WP_000136181.1 | YlaC family protein | - |
| PQQ06_RS17260 (3487858) | 3487858..3487998 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQQ06_RS17265 (3488004) | 3488004..3488264 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQQ06_RS17270 (3488489) | 3488489..3490039 | + | 1551 | WP_274898436.1 | EAL domain-containing protein | - |
| PQQ06_RS17280 (3490270) | 3490270..3490659 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| PQQ06_RS17285 (3490692) | 3490692..3491261 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270893 WP_001280991.1 NZ_CP117371:3486267-3486485 [Salmonella enterica subsp. enterica serovar Newport]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270893 WP_000344807.1 NZ_CP117371:3485865-3486239 [Salmonella enterica subsp. enterica serovar Newport]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|