Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4440838..4441619 | Replicon | chromosome |
Accession | NZ_CP117370 | ||
Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain RM054 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | PQP97_RS21840 | Protein ID | WP_000626099.1 |
Coordinates | 4440838..4441329 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | PQP97_RS21845 | Protein ID | WP_001110452.1 |
Coordinates | 4441326..4441619 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP97_RS21800 (4436024) | 4436024..4436266 | - | 243 | WP_197603740.1 | hypothetical protein | - |
PQP97_RS21805 (4436263) | 4436263..4436619 | - | 357 | WP_033567083.1 | hypothetical protein | - |
PQP97_RS21810 (4436616) | 4436616..4437488 | - | 873 | WP_033567082.1 | ParA family protein | - |
PQP97_RS21815 (4437679) | 4437679..4437756 | - | 78 | Protein_4267 | helix-turn-helix domain-containing protein | - |
PQP97_RS21820 (4437847) | 4437847..4438179 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
PQP97_RS21825 (4438251) | 4438251..4438628 | + | 378 | WP_000916345.1 | EthD family reductase | - |
PQP97_RS21830 (4439661) | 4439661..4439735 | + | 75 | Protein_4270 | porin family protein | - |
PQP97_RS21835 (4439838) | 4439838..4440590 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
PQP97_RS21840 (4440838) | 4440838..4441329 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
PQP97_RS21845 (4441326) | 4441326..4441619 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
PQP97_RS21850 (4441936) | 4441936..4442157 | + | 222 | WP_001576552.1 | hypothetical protein | - |
PQP97_RS21855 (4442422) | 4442422..4443297 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
PQP97_RS21860 (4443294) | 4443294..4443581 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQP97_RS21865 (4443604) | 4443604..4443819 | + | 216 | WP_001595136.1 | hypothetical protein | - |
PQP97_RS21870 (4443827) | 4443827..4444096 | + | 270 | WP_010989096.1 | hypothetical protein | - |
PQP97_RS21875 (4444390) | 4444390..4445295 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T270883 WP_000626099.1 NZ_CP117370:c4441329-4440838 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT270883 WP_001110452.1 NZ_CP117370:c4441619-4441326 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |