Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4230763..4231279 | Replicon | chromosome |
| Accession | NZ_CP117370 | ||
| Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain RM054 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | PQP97_RS20730 | Protein ID | WP_000220578.1 |
| Coordinates | 4230763..4231047 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQP97_RS20735 | Protein ID | WP_000212724.1 |
| Coordinates | 4231037..4231279 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP97_RS20715 (4225975) | 4225975..4227627 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
| PQP97_RS20720 (4228036) | 4228036..4230174 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQP97_RS20725 (4230295) | 4230295..4230759 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQP97_RS20730 (4230763) | 4230763..4231047 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP97_RS20735 (4231037) | 4231037..4231279 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQP97_RS20740 (4231357) | 4231357..4233270 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
| PQP97_RS20745 (4233287) | 4233287..4234027 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
| PQP97_RS20750 (4234024) | 4234024..4235142 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQP97_RS20755 (4235126) | 4235126..4236259 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T270882 WP_000220578.1 NZ_CP117370:c4231047-4230763 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |