Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3517595..3518215 | Replicon | chromosome |
Accession | NZ_CP117370 | ||
Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain RM054 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP97_RS17455 | Protein ID | WP_001280991.1 |
Coordinates | 3517997..3518215 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP97_RS17450 | Protein ID | WP_000344807.1 |
Coordinates | 3517595..3517969 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP97_RS17440 (3512734) | 3512734..3513927 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP97_RS17445 (3513950) | 3513950..3517099 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PQP97_RS17450 (3517595) | 3517595..3517969 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP97_RS17455 (3517997) | 3517997..3518215 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP97_RS17460 (3518394) | 3518394..3518945 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQP97_RS17465 (3519062) | 3519062..3519532 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQP97_RS17470 (3519588) | 3519588..3519728 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP97_RS17475 (3519734) | 3519734..3519994 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP97_RS17480 (3520219) | 3520219..3521769 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
PQP97_RS17490 (3522000) | 3522000..3522389 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQP97_RS17495 (3522422) | 3522422..3522991 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270878 WP_001280991.1 NZ_CP117370:3517997-3518215 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270878 WP_000344807.1 NZ_CP117370:3517595-3517969 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|