270864

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 11800..12455 Replicon plasmid pRM079_2
Accession NZ_CP117369
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM079

Toxin (Protein)


Gene name vagD Uniprot ID M7RF18
Locus tag PQQ12_RS25065 Protein ID WP_000812999.1
Coordinates 11800..12228 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID H9AC95
Locus tag PQQ12_RS25070 Protein ID WP_001261283.1
Coordinates 12225..12455 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ12_RS25030 (PQQ12_25030) 7201..7965 + 765 WP_000827659.1 K88 minor fimbrial subunit faeI -
PQQ12_RS25035 (PQQ12_25035) 7952..8227 + 276 WP_001020576.1 hypothetical protein -
PQQ12_RS25040 (PQQ12_25040) 8227..8940 + 714 WP_000801115.1 hypothetical protein -
PQQ12_RS25045 (PQQ12_25045) 9065..9649 + 585 WP_001575501.1 hypothetical protein -
PQQ12_RS25050 (PQQ12_25050) 9722..9934 + 213 WP_000063794.1 FaeA/PapI family transcriptional regulator -
PQQ12_RS25055 (PQQ12_25055) 10195..10356 + 162 WP_001816720.1 hypothetical protein -
PQQ12_RS25060 (PQQ12_25060) 10382..11230 + 849 WP_000175391.1 SdiA-regulated domain-containing protein -
PQQ12_RS25065 (PQQ12_25065) 11800..12228 - 429 WP_000812999.1 type II toxin-antitoxin system VapC family toxin Toxin
PQQ12_RS25070 (PQQ12_25070) 12225..12455 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQQ12_RS25075 (PQQ12_25075) 13200..13418 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA -
PQQ12_RS25080 (PQQ12_25080) 13420..13725 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB -
PQQ12_RS25085 (PQQ12_25085) 13727..14017 + 291 WP_001266176.1 hypothetical protein -
PQQ12_RS25090 (PQQ12_25090) 14014..14535 + 522 WP_000198608.1 hypothetical protein -
PQQ12_RS25095 (PQQ12_25095) 14570..15352 + 783 WP_000082169.1 site-specific integrase -
PQQ12_RS25100 (PQQ12_25100) 15361..16044 + 684 WP_001751692.1 EAL domain-containing protein -
PQQ12_RS25105 (PQQ12_25105) 16098..16586 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PQQ12_RS25110 (PQQ12_25110) 16580..16916 + 337 Protein_24 hypothetical protein -
PQQ12_RS25115 (PQQ12_25115) 16907..17248 + 342 Protein_25 LysM peptidoglycan-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..73152 73152


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-133)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15483.03 Da        Isoelectric Point: 7.6736

>T270864 WP_000812999.1 NZ_CP117369:c12228-11800 [Salmonella enterica subsp. enterica serovar Dublin]
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS

Download         Length: 429 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8737.83 Da        Isoelectric Point: 4.3775

>AT270864 WP_001261283.1 NZ_CP117369:c12455-12225 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7RF18

Antitoxin

Source ID Structure
AlphaFold DB A0A6X6R7C5

References