Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3450550..3451170 | Replicon | chromosome |
Accession | NZ_CP117365 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain RM089 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP78_RS17005 | Protein ID | WP_001280991.1 |
Coordinates | 3450952..3451170 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP78_RS17000 | Protein ID | WP_000344807.1 |
Coordinates | 3450550..3450924 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP78_RS16990 (3445689) | 3445689..3446882 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP78_RS16995 (3446905) | 3446905..3450054 | + | 3150 | WP_274891827.1 | efflux RND transporter permease AcrB | - |
PQP78_RS17000 (3450550) | 3450550..3450924 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP78_RS17005 (3450952) | 3450952..3451170 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP78_RS17010 (3451349) | 3451349..3451900 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQP78_RS17015 (3452017) | 3452017..3452487 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQP78_RS17020 (3452543) | 3452543..3452683 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP78_RS17025 (3452689) | 3452689..3452949 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP78_RS17030 (3453174) | 3453174..3454724 | + | 1551 | WP_000213138.1 | EAL domain-containing protein | - |
PQP78_RS17040 (3454955) | 3454955..3455344 | + | 390 | WP_000961287.1 | MGMT family protein | - |
PQP78_RS17045 (3455377) | 3455377..3455946 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270836 WP_001280991.1 NZ_CP117365:3450952-3451170 [Salmonella enterica subsp. enterica serovar Newport]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270836 WP_000344807.1 NZ_CP117365:3450550-3450924 [Salmonella enterica subsp. enterica serovar Newport]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|