Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 41743..42265 Replicon plasmid pRM092_2
Accession NZ_CP117364
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM092

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQQ00_RS24550 Protein ID WP_000220560.1
Coordinates 41984..42265 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQQ00_RS24545 Protein ID WP_000121743.1
Coordinates 41743..41994 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ00_RS24520 (PQQ00_24520) 37077..37697 + 621 WP_000864788.1 ParA family protein -
PQQ00_RS24525 (PQQ00_24525) 37749..37979 + 231 WP_000051066.1 plasmid partition protein ParG -
PQQ00_RS24530 (PQQ00_24530) 38618..38971 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
PQQ00_RS24535 (PQQ00_24535) 39108..39554 - 447 WP_001074381.1 hypothetical protein -
PQQ00_RS24540 (PQQ00_24540) 39594..40430 - 837 WP_001575533.1 replication initiation protein -
PQQ00_RS24545 (PQQ00_24545) 41743..41994 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQQ00_RS24550 (PQQ00_24550) 41984..42265 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQQ00_RS24555 (PQQ00_24555) 42411..42734 + 324 WP_001181909.1 hypothetical protein -
PQQ00_RS24560 (PQQ00_24560) 42779..43024 + 246 WP_000356542.1 hypothetical protein -
PQQ00_RS24565 (PQQ00_24565) 43014..43229 + 216 WP_001180117.1 hypothetical protein -
PQQ00_RS24570 (PQQ00_24570) 43322..43651 + 330 WP_000866650.1 hypothetical protein -
PQQ00_RS24575 (PQQ00_24575) 43694..43873 + 180 WP_001575529.1 hypothetical protein -
PQQ00_RS24580 (PQQ00_24580) 43943..44092 + 150 WP_000003880.1 hypothetical protein -
PQQ00_RS24585 (PQQ00_24585) 44105..44377 + 273 WP_000160399.1 hypothetical protein -
PQQ00_RS24590 (PQQ00_24590) 44703..45248 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
PQQ00_RS24595 (PQQ00_24595) 45251..46432 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..75466 75466


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T270827 WP_000220560.1 NZ_CP117364:41984-42265 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT270827 WP_000121743.1 NZ_CP117364:41743-41994 [Salmonella enterica subsp. enterica serovar Dublin]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References