Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 11800..12455 Replicon plasmid pRM092_2
Accession NZ_CP117364
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM092

Toxin (Protein)


Gene name vagD Uniprot ID M7RF18
Locus tag PQQ00_RS24350 Protein ID WP_000812999.1
Coordinates 11800..12228 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID H9AC95
Locus tag PQQ00_RS24355 Protein ID WP_001261283.1
Coordinates 12225..12455 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ00_RS24315 (PQQ00_24315) 7201..7965 + 765 WP_000827659.1 K88 minor fimbrial subunit faeI -
PQQ00_RS24320 (PQQ00_24320) 7952..8227 + 276 WP_001020576.1 hypothetical protein -
PQQ00_RS24325 (PQQ00_24325) 8227..8940 + 714 WP_000801115.1 hypothetical protein -
PQQ00_RS24330 (PQQ00_24330) 9065..9649 + 585 WP_001575501.1 hypothetical protein -
PQQ00_RS24335 (PQQ00_24335) 9722..9934 + 213 WP_000063794.1 FaeA/PapI family transcriptional regulator -
PQQ00_RS24340 (PQQ00_24340) 10195..10356 + 162 WP_001816720.1 hypothetical protein -
PQQ00_RS24345 (PQQ00_24345) 10382..11230 + 849 WP_000175391.1 SdiA-regulated domain-containing protein -
PQQ00_RS24350 (PQQ00_24350) 11800..12228 - 429 WP_000812999.1 type II toxin-antitoxin system VapC family toxin Toxin
PQQ00_RS24355 (PQQ00_24355) 12225..12455 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQQ00_RS24360 (PQQ00_24360) 13200..13418 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA -
PQQ00_RS24365 (PQQ00_24365) 13420..13725 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB -
PQQ00_RS24370 (PQQ00_24370) 13727..14017 + 291 WP_001266176.1 hypothetical protein -
PQQ00_RS24375 (PQQ00_24375) 14014..14535 + 522 WP_000198608.1 hypothetical protein -
PQQ00_RS24380 (PQQ00_24380) 14570..15352 + 783 WP_000082169.1 site-specific integrase -
PQQ00_RS24385 (PQQ00_24385) 15361..16044 + 684 WP_001751692.1 EAL domain-containing protein -
PQQ00_RS24390 (PQQ00_24390) 16098..16586 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PQQ00_RS24395 (PQQ00_24395) 16580..16916 + 337 Protein_24 hypothetical protein -
PQQ00_RS24400 (PQQ00_24400) 16907..17248 + 342 Protein_25 LysM peptidoglycan-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..75466 75466


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-133)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15483.03 Da        Isoelectric Point: 7.6736

>T270825 WP_000812999.1 NZ_CP117364:c12228-11800 [Salmonella enterica subsp. enterica serovar Dublin]
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS

Download         Length: 429 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8737.83 Da        Isoelectric Point: 4.3775

>AT270825 WP_001261283.1 NZ_CP117364:c12455-12225 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7RF18

Antitoxin

Source ID Structure
AlphaFold DB A0A6X6R7C5

References