Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4195743..4196293 Replicon chromosome
Accession NZ_CP117362
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM092

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQQ00_RS20680 Protein ID WP_001199743.1
Coordinates 4195743..4196051 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PQQ00_RS20685 Protein ID WP_001118105.1
Coordinates 4196054..4196293 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ00_RS20660 (4192317) 4192317..4193057 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PQQ00_RS20665 (4193179) 4193179..4193676 - 498 WP_001231942.1 SEF14 fimbria major subunit SefA -
PQQ00_RS20670 (4194032) 4194032..4195165 + 1134 Protein_4046 IS3 family transposase -
PQQ00_RS20675 (4195197) 4195197..4195337 - 141 Protein_4047 Arm DNA-binding domain-containing protein -
PQQ00_RS20680 (4195743) 4195743..4196051 - 309 WP_001199743.1 CcdB family protein Toxin
PQQ00_RS20685 (4196054) 4196054..4196293 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQQ00_RS20690 (4196402) 4196402..4196650 - 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
PQQ00_RS20695 (4196841) 4196841..4197272 - 432 Protein_4051 helix-turn-helix domain-containing protein -
PQQ00_RS20705 (4198029) 4198029..4199048 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
PQQ00_RS20710 (4199076) 4199076..4199606 - 531 WP_000896758.1 gluconokinase -
PQQ00_RS20715 (4199823) 4199823..4200854 + 1032 WP_000453348.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4194124..4197227 3103
- inside Genomic island - - 4177011..4196650 19639


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270819 WP_001199743.1 NZ_CP117362:c4196051-4195743 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT270819 WP_001118105.1 NZ_CP117362:c4196293-4196054 [Salmonella enterica subsp. enterica serovar Dublin]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References