Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3545490..3546110 | Replicon | chromosome |
| Accession | NZ_CP117362 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM092 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQQ00_RS17675 | Protein ID | WP_001280991.1 |
| Coordinates | 3545892..3546110 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PQQ00_RS17670 | Protein ID | WP_000344807.1 |
| Coordinates | 3545490..3545864 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ00_RS17660 (3540629) | 3540629..3541822 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQQ00_RS17665 (3541845) | 3541845..3544994 | + | 3150 | WP_052897443.1 | efflux RND transporter permease AcrB | - |
| PQQ00_RS17670 (3545490) | 3545490..3545864 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PQQ00_RS17675 (3545892) | 3545892..3546110 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQQ00_RS17680 (3546289) | 3546289..3546840 | + | 552 | WP_001278787.1 | maltose O-acetyltransferase | - |
| PQQ00_RS17685 (3546958) | 3546958..3547428 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| PQQ00_RS17690 (3547484) | 3547484..3547624 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQQ00_RS17695 (3547630) | 3547630..3547890 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQQ00_RS17700 (3548115) | 3548115..3549665 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| PQQ00_RS17710 (3549896) | 3549896..3550285 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| PQQ00_RS17715 (3550318) | 3550318..3550887 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270815 WP_001280991.1 NZ_CP117362:3545892-3546110 [Salmonella enterica subsp. enterica serovar Dublin]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270815 WP_000344807.1 NZ_CP117362:3545490-3545864 [Salmonella enterica subsp. enterica serovar Dublin]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|