Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 41128..41650 Replicon plasmid pRM094_2
Accession NZ_CP117361
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM094

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQP87_RS24655 Protein ID WP_000220560.1
Coordinates 41369..41650 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQP87_RS24650 Protein ID WP_000121743.1
Coordinates 41128..41379 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP87_RS24625 (PQP87_24625) 36539..37159 + 621 WP_000864788.1 ParA family protein -
PQP87_RS24630 (PQP87_24630) 37211..37441 + 231 WP_000051066.1 plasmid partition protein ParG -
PQP87_RS24635 (PQP87_24635) 38080..38433 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
PQP87_RS24640 (PQP87_24640) 38570..39016 - 447 WP_001074381.1 hypothetical protein -
PQP87_RS24645 (PQP87_24645) 39056..39892 - 837 WP_001575533.1 replication initiation protein -
PQP87_RS24650 (PQP87_24650) 41128..41379 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQP87_RS24655 (PQP87_24655) 41369..41650 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQP87_RS24660 (PQP87_24660) 41796..42119 + 324 WP_001181909.1 hypothetical protein -
PQP87_RS24665 (PQP87_24665) 42164..42409 + 246 WP_000356542.1 hypothetical protein -
PQP87_RS24670 (PQP87_24670) 42399..42614 + 216 WP_001180117.1 hypothetical protein -
PQP87_RS24675 (PQP87_24675) 42707..43036 + 330 WP_000866650.1 hypothetical protein -
PQP87_RS24680 (PQP87_24680) 43079..43258 + 180 WP_001575529.1 hypothetical protein -
PQP87_RS24685 (PQP87_24685) 43280..43477 + 198 WP_001675595.1 hypothetical protein -
PQP87_RS24690 (PQP87_24690) 43490..43762 + 273 WP_000160399.1 hypothetical protein -
PQP87_RS24695 (PQP87_24695) 44088..44633 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
PQP87_RS24700 (PQP87_24700) 44636..45817 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..74851 74851


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T270804 WP_000220560.1 NZ_CP117361:41369-41650 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT270804 WP_000121743.1 NZ_CP117361:41128-41379 [Salmonella enterica subsp. enterica serovar Dublin]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References