Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 13200..13725 | Replicon | plasmid pRM094_2 |
Accession | NZ_CP117361 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM094 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | I3W3D5 |
Locus tag | PQP87_RS24475 | Protein ID | WP_001159863.1 |
Coordinates | 13420..13725 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | M7S5D0 |
Locus tag | PQP87_RS24470 | Protein ID | WP_000813641.1 |
Coordinates | 13200..13418 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP87_RS24435 (PQP87_24435) | 8227..8940 | + | 714 | WP_000801115.1 | hypothetical protein | - |
PQP87_RS24440 (PQP87_24440) | 9065..9649 | + | 585 | WP_001575501.1 | hypothetical protein | - |
PQP87_RS24445 (PQP87_24445) | 9722..9934 | + | 213 | WP_000063794.1 | FaeA/PapI family transcriptional regulator | - |
PQP87_RS24450 (PQP87_24450) | 10195..10356 | + | 162 | WP_001816720.1 | hypothetical protein | - |
PQP87_RS24455 (PQP87_24455) | 10382..11230 | + | 849 | WP_000175391.1 | SdiA-regulated domain-containing protein | - |
PQP87_RS24460 (PQP87_24460) | 11800..12228 | - | 429 | WP_000812999.1 | type II toxin-antitoxin system VapC family toxin | - |
PQP87_RS24465 (PQP87_24465) | 12225..12455 | - | 231 | WP_001261283.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PQP87_RS24470 (PQP87_24470) | 13200..13418 | + | 219 | WP_000813641.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PQP87_RS24475 (PQP87_24475) | 13420..13725 | + | 306 | WP_001159863.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PQP87_RS24480 (PQP87_24480) | 13727..14017 | + | 291 | WP_001266176.1 | hypothetical protein | - |
PQP87_RS24485 (PQP87_24485) | 14014..14535 | + | 522 | WP_000198608.1 | hypothetical protein | - |
PQP87_RS24490 (PQP87_24490) | 14570..15352 | + | 783 | WP_000082169.1 | site-specific integrase | - |
PQP87_RS24495 (PQP87_24495) | 15361..16044 | + | 684 | WP_001751692.1 | EAL domain-containing protein | - |
PQP87_RS24500 (PQP87_24500) | 16098..16586 | + | 489 | WP_001075507.1 | CaiF/GrlA family transcriptional regulator | - |
PQP87_RS24505 (PQP87_24505) | 16580..16916 | + | 337 | Protein_24 | hypothetical protein | - |
PQP87_RS24510 (PQP87_24510) | 16907..17248 | + | 342 | Protein_25 | LysM peptidoglycan-binding domain-containing protein | - |
PQP87_RS24515 (PQP87_24515) | 17143..17688 | + | 546 | WP_071591236.1 | inverse autotransporter beta domain-containing protein | - |
PQP87_RS24520 (PQP87_24520) | 17755..18114 | - | 360 | WP_001675600.1 | helix-turn-helix domain-containing protein | - |
PQP87_RS24525 (PQP87_24525) | 18171..18596 | + | 426 | WP_000064919.1 | IS200/IS605 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | faeH / faeI / spvC / spvB | 1..74851 | 74851 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11587.48 Da Isoelectric Point: 6.9787
>T270803 WP_001159863.1 NZ_CP117361:13420-13725 [Salmonella enterica subsp. enterica serovar Dublin]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I3W3D5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656ICA6 |