Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 11800..12455 Replicon plasmid pRM094_2
Accession NZ_CP117361
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM094

Toxin (Protein)


Gene name vagD Uniprot ID M7RF18
Locus tag PQP87_RS24460 Protein ID WP_000812999.1
Coordinates 11800..12228 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID H9AC95
Locus tag PQP87_RS24465 Protein ID WP_001261283.1
Coordinates 12225..12455 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP87_RS24425 (PQP87_24425) 7201..7965 + 765 WP_000827659.1 K88 minor fimbrial subunit faeI -
PQP87_RS24430 (PQP87_24430) 7952..8227 + 276 WP_001020576.1 hypothetical protein -
PQP87_RS24435 (PQP87_24435) 8227..8940 + 714 WP_000801115.1 hypothetical protein -
PQP87_RS24440 (PQP87_24440) 9065..9649 + 585 WP_001575501.1 hypothetical protein -
PQP87_RS24445 (PQP87_24445) 9722..9934 + 213 WP_000063794.1 FaeA/PapI family transcriptional regulator -
PQP87_RS24450 (PQP87_24450) 10195..10356 + 162 WP_001816720.1 hypothetical protein -
PQP87_RS24455 (PQP87_24455) 10382..11230 + 849 WP_000175391.1 SdiA-regulated domain-containing protein -
PQP87_RS24460 (PQP87_24460) 11800..12228 - 429 WP_000812999.1 type II toxin-antitoxin system VapC family toxin Toxin
PQP87_RS24465 (PQP87_24465) 12225..12455 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQP87_RS24470 (PQP87_24470) 13200..13418 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA -
PQP87_RS24475 (PQP87_24475) 13420..13725 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB -
PQP87_RS24480 (PQP87_24480) 13727..14017 + 291 WP_001266176.1 hypothetical protein -
PQP87_RS24485 (PQP87_24485) 14014..14535 + 522 WP_000198608.1 hypothetical protein -
PQP87_RS24490 (PQP87_24490) 14570..15352 + 783 WP_000082169.1 site-specific integrase -
PQP87_RS24495 (PQP87_24495) 15361..16044 + 684 WP_001751692.1 EAL domain-containing protein -
PQP87_RS24500 (PQP87_24500) 16098..16586 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PQP87_RS24505 (PQP87_24505) 16580..16916 + 337 Protein_24 hypothetical protein -
PQP87_RS24510 (PQP87_24510) 16907..17248 + 342 Protein_25 LysM peptidoglycan-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..74851 74851


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-133)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15483.03 Da        Isoelectric Point: 7.6736

>T270802 WP_000812999.1 NZ_CP117361:c12228-11800 [Salmonella enterica subsp. enterica serovar Dublin]
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS

Download         Length: 429 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8737.83 Da        Isoelectric Point: 4.3775

>AT270802 WP_001261283.1 NZ_CP117361:c12455-12225 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7RF18

Antitoxin

Source ID Structure
AlphaFold DB A0A6X6R7C5

References