Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4145254..4145830 | Replicon | chromosome |
| Accession | NZ_CP117359 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM094 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | PQP87_RS20450 | Protein ID | WP_001131963.1 |
| Coordinates | 4145543..4145830 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A5U1K3M6 |
| Locus tag | PQP87_RS20445 | Protein ID | WP_000063141.1 |
| Coordinates | 4145254..4145556 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP87_RS20430 (4141764) | 4141764..4143914 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
| PQP87_RS20435 (4144009) | 4144009..4144212 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| PQP87_RS20440 (4144223) | 4144223..4145179 | + | 957 | WP_000187843.1 | GTPase | - |
| PQP87_RS20445 (4145254) | 4145254..4145556 | - | 303 | WP_000063141.1 | BrnA antitoxin family protein | Antitoxin |
| PQP87_RS20450 (4145543) | 4145543..4145830 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| PQP87_RS20455 (4146254) | 4146254..4148095 | + | 1842 | WP_000974635.1 | nuclease-related domain-containing DEAD/DEAH box helicase | - |
| PQP87_RS20460 (4148708) | 4148708..4149283 | + | 576 | WP_000593782.1 | restriction endonuclease subunit S | - |
| PQP87_RS20465 (4149288) | 4149288..4150352 | + | 1065 | WP_223151228.1 | N-6 DNA methylase | - |
| PQP87_RS20470 (4150574) | 4150574..4150708 | - | 135 | WP_001055725.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T270795 WP_001131963.1 NZ_CP117359:c4145830-4145543 [Salmonella enterica subsp. enterica serovar Dublin]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11431.99 Da Isoelectric Point: 9.8948
>AT270795 WP_000063141.1 NZ_CP117359:c4145556-4145254 [Salmonella enterica subsp. enterica serovar Dublin]
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRDKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRDKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|