Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3545260..3545880 | Replicon | chromosome |
Accession | NZ_CP117359 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM094 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQP87_RS17685 | Protein ID | WP_001280991.1 |
Coordinates | 3545662..3545880 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQP87_RS17680 | Protein ID | WP_000344807.1 |
Coordinates | 3545260..3545634 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP87_RS17670 (3540399) | 3540399..3541592 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQP87_RS17675 (3541615) | 3541615..3544764 | + | 3150 | WP_052897443.1 | efflux RND transporter permease AcrB | - |
PQP87_RS17680 (3545260) | 3545260..3545634 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQP87_RS17685 (3545662) | 3545662..3545880 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQP87_RS17690 (3546059) | 3546059..3546610 | + | 552 | WP_001278787.1 | maltose O-acetyltransferase | - |
PQP87_RS17695 (3546728) | 3546728..3547198 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQP87_RS17700 (3547254) | 3547254..3547394 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQP87_RS17705 (3547400) | 3547400..3547660 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQP87_RS17710 (3547885) | 3547885..3549435 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
PQP87_RS17720 (3549666) | 3549666..3550055 | + | 390 | WP_000961287.1 | MGMT family protein | - |
PQP87_RS17725 (3550088) | 3550088..3550657 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270792 WP_001280991.1 NZ_CP117359:3545662-3545880 [Salmonella enterica subsp. enterica serovar Dublin]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270792 WP_000344807.1 NZ_CP117359:3545260-3545634 [Salmonella enterica subsp. enterica serovar Dublin]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|