Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 309891..310477 Replicon chromosome
Accession NZ_CP117359
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM094

Toxin (Protein)


Gene name doc Uniprot ID M7S4C0
Locus tag PQP87_RS01425 Protein ID WP_001575091.1
Coordinates 310109..310477 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag PQP87_RS01420 Protein ID WP_001520924.1
Coordinates 309891..310112 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP87_RS01395 (304912) 304912..306021 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
PQP87_RS01400 (306081) 306081..307007 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PQP87_RS01405 (307004) 307004..308281 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
PQP87_RS01410 (308278) 308278..309045 + 768 WP_001751764.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PQP87_RS01415 (309047) 309047..309760 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PQP87_RS01420 (309891) 309891..310112 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PQP87_RS01425 (310109) 310109..310477 + 369 WP_001575091.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PQP87_RS01430 (310736) 310736..312052 + 1317 WP_000624752.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PQP87_RS01435 (312157) 312157..313044 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PQP87_RS01440 (313041) 313041..313886 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PQP87_RS01445 (313888) 313888..314958 + 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 307004..315695 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13701.98 Da        Isoelectric Point: 5.6993

>T270783 WP_001575091.1 NZ_CP117359:310109-310477 [Salmonella enterica subsp. enterica serovar Dublin]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT270783 WP_001520924.1 NZ_CP117359:309891-310112 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7S4C0

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References