Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 24351..24976 | Replicon | plasmid pRM096_1 |
Accession | NZ_CP117358 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM096 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PQQ15_RS23795 | Protein ID | WP_000911322.1 |
Coordinates | 24578..24976 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | PQQ15_RS23790 | Protein ID | WP_000450265.1 |
Coordinates | 24351..24578 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ15_RS23790 (PQQ15_23790) | 24351..24578 | + | 228 | WP_000450265.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQQ15_RS23795 (PQQ15_23795) | 24578..24976 | + | 399 | WP_000911322.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PQQ15_RS23800 (PQQ15_23800) | 24985..27147 | - | 2163 | WP_084568444.1 | type IV conjugative transfer system coupling protein TraD | - |
PQQ15_RS23805 (PQQ15_23805) | 27524..28255 | - | 732 | WP_000782438.1 | conjugal transfer complement resistance protein TraT | - |
PQQ15_RS23810 (PQQ15_23810) | 28291..28785 | - | 495 | WP_010999946.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | pefB / pefA / pefC / pefD / rck / spvB / spvC / fdeC | 1..93864 | 93864 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14887.13 Da Isoelectric Point: 8.5264
>T270781 WP_000911322.1 NZ_CP117358:24578-24976 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|