Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4345806..4346587 | Replicon | chromosome |
Accession | NZ_CP117357 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM096 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | PQQ15_RS21260 | Protein ID | WP_000626099.1 |
Coordinates | 4345806..4346297 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | PQQ15_RS21265 | Protein ID | WP_001110452.1 |
Coordinates | 4346294..4346587 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ15_RS21225 (4341801) | 4341801..4342376 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
PQQ15_RS21235 (4342647) | 4342647..4342724 | - | 78 | Protein_4151 | helix-turn-helix domain-containing protein | - |
PQQ15_RS21240 (4342815) | 4342815..4343147 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
PQQ15_RS21245 (4343219) | 4343219..4343596 | + | 378 | WP_000916345.1 | EthD family reductase | - |
PQQ15_RS21250 (4344629) | 4344629..4344703 | + | 75 | Protein_4154 | porin family protein | - |
PQQ15_RS21255 (4344806) | 4344806..4345558 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
PQQ15_RS21260 (4345806) | 4345806..4346297 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
PQQ15_RS21265 (4346294) | 4346294..4346587 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
PQQ15_RS21270 (4346904) | 4346904..4347125 | + | 222 | WP_001576552.1 | hypothetical protein | - |
PQQ15_RS21275 (4347390) | 4347390..4348265 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
PQQ15_RS21280 (4348262) | 4348262..4348549 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PQQ15_RS21285 (4348572) | 4348572..4348787 | + | 216 | WP_001595136.1 | hypothetical protein | - |
PQQ15_RS21290 (4348795) | 4348795..4349064 | + | 270 | WP_010989096.1 | hypothetical protein | - |
PQQ15_RS21295 (4349358) | 4349358..4350263 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T270778 WP_000626099.1 NZ_CP117357:c4346297-4345806 [Salmonella enterica subsp. enterica serovar Typhimurium]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT270778 WP_001110452.1 NZ_CP117357:c4346587-4346294 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|