Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3523335..3523955 | Replicon | chromosome |
Accession | NZ_CP117357 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM096 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ15_RS17440 | Protein ID | WP_001280991.1 |
Coordinates | 3523737..3523955 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQQ15_RS17435 | Protein ID | WP_000344807.1 |
Coordinates | 3523335..3523709 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ15_RS17425 (3518475) | 3518475..3519668 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ15_RS17430 (3519691) | 3519691..3522839 | + | 3149 | Protein_3407 | efflux RND transporter permease AcrB | - |
PQQ15_RS17435 (3523335) | 3523335..3523709 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ15_RS17440 (3523737) | 3523737..3523955 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ15_RS17445 (3524134) | 3524134..3524685 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQQ15_RS17450 (3524802) | 3524802..3525272 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQQ15_RS17455 (3525328) | 3525328..3525468 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ15_RS17460 (3525474) | 3525474..3525734 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ15_RS17465 (3525959) | 3525959..3527509 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
PQQ15_RS17475 (3527740) | 3527740..3528129 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQQ15_RS17480 (3528162) | 3528162..3528731 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270773 WP_001280991.1 NZ_CP117357:3523737-3523955 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270773 WP_000344807.1 NZ_CP117357:3523335-3523709 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|