Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 41569..42091 Replicon plasmid pRM099_2
Accession NZ_CP117356
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM099

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQP84_RS24535 Protein ID WP_000220560.1
Coordinates 41810..42091 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQP84_RS24530 Protein ID WP_000121743.1
Coordinates 41569..41820 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP84_RS24505 (PQP84_24505) 36981..37600 + 620 Protein_49 ParA family protein -
PQP84_RS24510 (PQP84_24510) 37652..37882 + 231 WP_000051066.1 plasmid partition protein ParG -
PQP84_RS24515 (PQP84_24515) 38521..38874 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
PQP84_RS24520 (PQP84_24520) 39011..39457 - 447 WP_001074381.1 hypothetical protein -
PQP84_RS24525 (PQP84_24525) 39497..40333 - 837 WP_001575533.1 replication initiation protein -
PQP84_RS24530 (PQP84_24530) 41569..41820 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQP84_RS24535 (PQP84_24535) 41810..42091 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQP84_RS24540 (PQP84_24540) 42237..42560 + 324 WP_274891767.1 hypothetical protein -
PQP84_RS24545 (PQP84_24545) 42605..42850 + 246 WP_000356542.1 hypothetical protein -
PQP84_RS24550 (PQP84_24550) 42840..43055 + 216 WP_001180117.1 hypothetical protein -
PQP84_RS24555 (PQP84_24555) 43148..43477 + 330 WP_000866650.1 hypothetical protein -
PQP84_RS24560 (PQP84_24560) 43520..43699 + 180 WP_001575529.1 hypothetical protein -
PQP84_RS24565 (PQP84_24565) 43721..43918 + 198 WP_001675595.1 hypothetical protein -
PQP84_RS24570 (PQP84_24570) 43931..44203 + 273 WP_000160399.1 hypothetical protein -
PQP84_RS24575 (PQP84_24575) 44529..45074 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
PQP84_RS24580 (PQP84_24580) 45077..46258 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..75391 75391


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T270761 WP_000220560.1 NZ_CP117356:41810-42091 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT270761 WP_000121743.1 NZ_CP117356:41569-41820 [Salmonella enterica subsp. enterica serovar Dublin]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References