Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4236156..4236672 | Replicon | chromosome |
| Accession | NZ_CP117354 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM099 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | M7RIY5 |
| Locus tag | PQP84_RS20880 | Protein ID | WP_000220574.1 |
| Coordinates | 4236156..4236440 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQP84_RS20885 | Protein ID | WP_000212724.1 |
| Coordinates | 4236430..4236672 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP84_RS20865 (4231272) | 4231272..4232924 | + | 1653 | WP_001751520.1 | alpha,alpha-phosphotrehalase | - |
| PQP84_RS20870 (4233333) | 4233333..4235471 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQP84_RS20875 (4235688) | 4235688..4236152 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQP84_RS20880 (4236156) | 4236156..4236440 | - | 285 | WP_000220574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP84_RS20885 (4236430) | 4236430..4236672 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQP84_RS20890 (4236750) | 4236750..4238663 | - | 1914 | WP_001212138.1 | PRD domain-containing protein | - |
| PQP84_RS20895 (4238680) | 4238680..4239420 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| PQP84_RS20900 (4239417) | 4239417..4240535 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQP84_RS20905 (4240519) | 4240519..4241651 | - | 1133 | Protein_4092 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10869.68 Da Isoelectric Point: 9.8739
>T270754 WP_000220574.1 NZ_CP117354:c4236440-4236156 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7RIY5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |