Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3544806..3545426 | Replicon | chromosome |
| Accession | NZ_CP117354 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM099 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PQP84_RS17670 | Protein ID | WP_001280991.1 |
| Coordinates | 3545208..3545426 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PQP84_RS17665 | Protein ID | WP_000344807.1 |
| Coordinates | 3544806..3545180 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP84_RS17655 (3539945) | 3539945..3541138 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PQP84_RS17660 (3541161) | 3541161..3544310 | + | 3150 | WP_052897443.1 | efflux RND transporter permease AcrB | - |
| PQP84_RS17665 (3544806) | 3544806..3545180 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PQP84_RS17670 (3545208) | 3545208..3545426 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PQP84_RS17675 (3545605) | 3545605..3546156 | + | 552 | WP_001278787.1 | maltose O-acetyltransferase | - |
| PQP84_RS17680 (3546274) | 3546274..3546744 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| PQP84_RS17685 (3546800) | 3546800..3546940 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PQP84_RS17690 (3546946) | 3546946..3547206 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PQP84_RS17695 (3547431) | 3547431..3548981 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| PQP84_RS17705 (3549212) | 3549212..3549601 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| PQP84_RS17710 (3549634) | 3549634..3550203 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270749 WP_001280991.1 NZ_CP117354:3545208-3545426 [Salmonella enterica subsp. enterica serovar Dublin]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270749 WP_000344807.1 NZ_CP117354:3544806-3545180 [Salmonella enterica subsp. enterica serovar Dublin]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|