Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 309889..310475 | Replicon | chromosome |
| Accession | NZ_CP117354 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM099 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | M7S4C0 |
| Locus tag | PQP84_RS01425 | Protein ID | WP_001575091.1 |
| Coordinates | 310107..310475 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | M7SDJ3 |
| Locus tag | PQP84_RS01420 | Protein ID | WP_001520924.1 |
| Coordinates | 309889..310110 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP84_RS01395 (304910) | 304910..306019 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| PQP84_RS01400 (306079) | 306079..307005 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| PQP84_RS01405 (307002) | 307002..308279 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| PQP84_RS01410 (308276) | 308276..309043 | + | 768 | WP_001751764.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| PQP84_RS01415 (309045) | 309045..309758 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| PQP84_RS01420 (309889) | 309889..310110 | + | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PQP84_RS01425 (310107) | 310107..310475 | + | 369 | WP_001575091.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PQP84_RS01430 (310732) | 310732..312048 | + | 1317 | WP_000624752.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| PQP84_RS01435 (312153) | 312153..313040 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| PQP84_RS01440 (313037) | 313037..313882 | + | 846 | WP_128297892.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| PQP84_RS01445 (313884) | 313884..314954 | + | 1071 | WP_000907846.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 307002..315691 | 8689 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13701.98 Da Isoelectric Point: 5.6993
>T270740 WP_001575091.1 NZ_CP117354:310107-310475 [Salmonella enterica subsp. enterica serovar Dublin]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPERAEALMYRVLNQIEYEGVTDVWLLAAMHLLTISRGYIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7S4C0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z871 |