Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 41028..41550 Replicon plasmid pRM100_2
Accession NZ_CP117353
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM100

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQQ10_RS24650 Protein ID WP_000220560.1
Coordinates 41269..41550 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQQ10_RS24645 Protein ID WP_000121743.1
Coordinates 41028..41279 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ10_RS24620 (PQQ10_24620) 36440..37059 + 620 Protein_48 ParA family protein -
PQQ10_RS24625 (PQQ10_24625) 37111..37341 + 231 WP_000051066.1 plasmid partition protein ParG -
PQQ10_RS24630 (PQQ10_24630) 37980..38333 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
PQQ10_RS24635 (PQQ10_24635) 38470..38916 - 447 WP_001074381.1 hypothetical protein -
PQQ10_RS24640 (PQQ10_24640) 38956..39792 - 837 WP_001575533.1 replication initiation protein -
PQQ10_RS24645 (PQQ10_24645) 41028..41279 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQQ10_RS24650 (PQQ10_24650) 41269..41550 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQQ10_RS24655 (PQQ10_24655) 41696..42019 + 324 WP_274896077.1 hypothetical protein -
PQQ10_RS24660 (PQQ10_24660) 42064..42309 + 246 WP_000356542.1 hypothetical protein -
PQQ10_RS24665 (PQQ10_24665) 42299..42514 + 216 WP_001180117.1 hypothetical protein -
PQQ10_RS24670 (PQQ10_24670) 42607..42936 + 330 WP_000866650.1 hypothetical protein -
PQQ10_RS24675 (PQQ10_24675) 42979..43158 + 180 WP_001575529.1 hypothetical protein -
PQQ10_RS24680 (PQQ10_24680) 43180..43377 + 198 WP_001675595.1 hypothetical protein -
PQQ10_RS24685 (PQQ10_24685) 43390..43662 + 273 WP_000160399.1 hypothetical protein -
PQQ10_RS24690 (PQQ10_24690) 43988..44533 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
PQQ10_RS24695 (PQQ10_24695) 44536..45717 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - faeH / faeI / spvC / spvB 1..74850 74850


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T270738 WP_000220560.1 NZ_CP117353:41269-41550 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT270738 WP_000121743.1 NZ_CP117353:41028-41279 [Salmonella enterica subsp. enterica serovar Dublin]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References