Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DnaT |
| Location | 41028..41550 | Replicon | plasmid pRM100_2 |
| Accession | NZ_CP117353 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM100 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G3CAN5 |
| Locus tag | PQQ10_RS24650 | Protein ID | WP_000220560.1 |
| Coordinates | 41269..41550 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G3CAG1 |
| Locus tag | PQQ10_RS24645 | Protein ID | WP_000121743.1 |
| Coordinates | 41028..41279 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ10_RS24620 (PQQ10_24620) | 36440..37059 | + | 620 | Protein_48 | ParA family protein | - |
| PQQ10_RS24625 (PQQ10_24625) | 37111..37341 | + | 231 | WP_000051066.1 | plasmid partition protein ParG | - |
| PQQ10_RS24630 (PQQ10_24630) | 37980..38333 | - | 354 | WP_001675596.1 | DNA distortion polypeptide 3 | - |
| PQQ10_RS24635 (PQQ10_24635) | 38470..38916 | - | 447 | WP_001074381.1 | hypothetical protein | - |
| PQQ10_RS24640 (PQQ10_24640) | 38956..39792 | - | 837 | WP_001575533.1 | replication initiation protein | - |
| PQQ10_RS24645 (PQQ10_24645) | 41028..41279 | + | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
| PQQ10_RS24650 (PQQ10_24650) | 41269..41550 | + | 282 | WP_000220560.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQQ10_RS24655 (PQQ10_24655) | 41696..42019 | + | 324 | WP_274896077.1 | hypothetical protein | - |
| PQQ10_RS24660 (PQQ10_24660) | 42064..42309 | + | 246 | WP_000356542.1 | hypothetical protein | - |
| PQQ10_RS24665 (PQQ10_24665) | 42299..42514 | + | 216 | WP_001180117.1 | hypothetical protein | - |
| PQQ10_RS24670 (PQQ10_24670) | 42607..42936 | + | 330 | WP_000866650.1 | hypothetical protein | - |
| PQQ10_RS24675 (PQQ10_24675) | 42979..43158 | + | 180 | WP_001575529.1 | hypothetical protein | - |
| PQQ10_RS24680 (PQQ10_24680) | 43180..43377 | + | 198 | WP_001675595.1 | hypothetical protein | - |
| PQQ10_RS24685 (PQQ10_24685) | 43390..43662 | + | 273 | WP_000160399.1 | hypothetical protein | - |
| PQQ10_RS24690 (PQQ10_24690) | 43988..44533 | + | 546 | WP_000757691.1 | DNA distortion polypeptide 1 | - |
| PQQ10_RS24695 (PQQ10_24695) | 44536..45717 | + | 1182 | WP_000539536.1 | MobP1 family relaxase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | faeH / faeI / spvC / spvB | 1..74850 | 74850 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11005.83 Da Isoelectric Point: 10.5938
>T270738 WP_000220560.1 NZ_CP117353:41269-41550 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G3CAN5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3S5I301 |