Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 11701..12356 | Replicon | plasmid pRM100_2 |
| Accession | NZ_CP117353 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM100 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | M7RF18 |
| Locus tag | PQQ10_RS24455 | Protein ID | WP_000812999.1 |
| Coordinates | 11701..12129 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | H9AC95 |
| Locus tag | PQQ10_RS24460 | Protein ID | WP_001261283.1 |
| Coordinates | 12126..12356 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ10_RS24420 (PQQ10_24420) | 7102..7866 | + | 765 | WP_000827659.1 | K88 minor fimbrial subunit faeI | - |
| PQQ10_RS24425 (PQQ10_24425) | 7853..8128 | + | 276 | WP_001020576.1 | hypothetical protein | - |
| PQQ10_RS24430 (PQQ10_24430) | 8128..8841 | + | 714 | WP_000801115.1 | hypothetical protein | - |
| PQQ10_RS24435 (PQQ10_24435) | 8966..9550 | + | 585 | WP_001575501.1 | hypothetical protein | - |
| PQQ10_RS24440 (PQQ10_24440) | 9623..9835 | + | 213 | WP_000063794.1 | FaeA/PapI family transcriptional regulator | - |
| PQQ10_RS24445 (PQQ10_24445) | 10096..10257 | + | 162 | WP_001816720.1 | hypothetical protein | - |
| PQQ10_RS24450 (PQQ10_24450) | 10283..11131 | + | 849 | WP_000175391.1 | SdiA-regulated domain-containing protein | - |
| PQQ10_RS24455 (PQQ10_24455) | 11701..12129 | - | 429 | WP_000812999.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PQQ10_RS24460 (PQQ10_24460) | 12126..12356 | - | 231 | WP_001261283.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PQQ10_RS24465 (PQQ10_24465) | 13101..13319 | + | 219 | WP_000813641.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| PQQ10_RS24470 (PQQ10_24470) | 13321..13626 | + | 306 | WP_001159863.1 | type II toxin-antitoxin system toxin CcdB | - |
| PQQ10_RS24475 (PQQ10_24475) | 13628..13918 | + | 291 | WP_001266176.1 | hypothetical protein | - |
| PQQ10_RS24480 (PQQ10_24480) | 13915..14436 | + | 522 | WP_000198608.1 | hypothetical protein | - |
| PQQ10_RS24485 (PQQ10_24485) | 14471..15253 | + | 783 | WP_000082169.1 | site-specific integrase | - |
| PQQ10_RS24490 (PQQ10_24490) | 15262..15945 | + | 684 | WP_001751692.1 | EAL domain-containing protein | - |
| PQQ10_RS24495 (PQQ10_24495) | 15999..16487 | + | 489 | WP_001075507.1 | CaiF/GrlA family transcriptional regulator | - |
| PQQ10_RS24500 (PQQ10_24500) | 16481..16817 | + | 337 | Protein_24 | hypothetical protein | - |
| PQQ10_RS24505 (PQQ10_24505) | 16727..17149 | + | 423 | WP_274896079.1 | LysM peptidoglycan-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | faeH / faeI / spvC / spvB | 1..74850 | 74850 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15483.03 Da Isoelectric Point: 7.6736
>T270736 WP_000812999.1 NZ_CP117353:c12129-11701 [Salmonella enterica subsp. enterica serovar Dublin]
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7RF18 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6X6R7C5 |