Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4190079..4190629 Replicon chromosome
Accession NZ_CP117351
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM100

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag PQQ10_RS20670 Protein ID WP_001199743.1
Coordinates 4190079..4190387 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag PQQ10_RS20675 Protein ID WP_001118105.1
Coordinates 4190390..4190629 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQQ10_RS20650 (4186653) 4186653..4187393 - 741 WP_001575372.1 SEF14/SEF18 fimbria chaperone SefB -
PQQ10_RS20655 (4187515) 4187515..4188045 - 531 WP_000909460.1 SEF14 fimbria major subunit SefA -
PQQ10_RS20660 (4188368) 4188368..4189501 + 1134 Protein_4045 IS3 family transposase -
PQQ10_RS20665 (4189533) 4189533..4189673 - 141 Protein_4046 Arm DNA-binding domain-containing protein -
PQQ10_RS20670 (4190079) 4190079..4190387 - 309 WP_001199743.1 CcdB family protein Toxin
PQQ10_RS20675 (4190390) 4190390..4190629 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PQQ10_RS20680 (4190738) 4190738..4190986 - 249 WP_000168389.1 ribbon-helix-helix domain-containing protein -
PQQ10_RS20685 (4191177) 4191177..4191608 - 432 Protein_4050 helix-turn-helix domain-containing protein -
PQQ10_RS20695 (4192365) 4192365..4193384 + 1020 Protein_4051 NAD(P)-dependent alcohol dehydrogenase -
PQQ10_RS20700 (4193412) 4193412..4193942 - 531 WP_000896758.1 gluconokinase -
PQQ10_RS20705 (4194159) 4194159..4195190 + 1032 WP_000453348.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4188460..4191563 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T270730 WP_001199743.1 NZ_CP117351:c4190387-4190079 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT270730 WP_001118105.1 NZ_CP117351:c4190629-4190390 [Salmonella enterica subsp. enterica serovar Dublin]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References