Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4190079..4190629 | Replicon | chromosome |
| Accession | NZ_CP117351 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM100 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | PQQ10_RS20670 | Protein ID | WP_001199743.1 |
| Coordinates | 4190079..4190387 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | PQQ10_RS20675 | Protein ID | WP_001118105.1 |
| Coordinates | 4190390..4190629 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQQ10_RS20650 (4186653) | 4186653..4187393 | - | 741 | WP_001575372.1 | SEF14/SEF18 fimbria chaperone SefB | - |
| PQQ10_RS20655 (4187515) | 4187515..4188045 | - | 531 | WP_000909460.1 | SEF14 fimbria major subunit SefA | - |
| PQQ10_RS20660 (4188368) | 4188368..4189501 | + | 1134 | Protein_4045 | IS3 family transposase | - |
| PQQ10_RS20665 (4189533) | 4189533..4189673 | - | 141 | Protein_4046 | Arm DNA-binding domain-containing protein | - |
| PQQ10_RS20670 (4190079) | 4190079..4190387 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| PQQ10_RS20675 (4190390) | 4190390..4190629 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| PQQ10_RS20680 (4190738) | 4190738..4190986 | - | 249 | WP_000168389.1 | ribbon-helix-helix domain-containing protein | - |
| PQQ10_RS20685 (4191177) | 4191177..4191608 | - | 432 | Protein_4050 | helix-turn-helix domain-containing protein | - |
| PQQ10_RS20695 (4192365) | 4192365..4193384 | + | 1020 | Protein_4051 | NAD(P)-dependent alcohol dehydrogenase | - |
| PQQ10_RS20700 (4193412) | 4193412..4193942 | - | 531 | WP_000896758.1 | gluconokinase | - |
| PQQ10_RS20705 (4194159) | 4194159..4195190 | + | 1032 | WP_000453348.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 4188460..4191563 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T270730 WP_001199743.1 NZ_CP117351:c4190387-4190079 [Salmonella enterica subsp. enterica serovar Dublin]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |