Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3539872..3540492 | Replicon | chromosome |
Accession | NZ_CP117351 | ||
Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM100 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ10_RS17665 | Protein ID | WP_001280991.1 |
Coordinates | 3540274..3540492 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQQ10_RS17660 | Protein ID | WP_000344807.1 |
Coordinates | 3539872..3540246 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ10_RS17650 (3535012) | 3535012..3536205 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ10_RS17655 (3536228) | 3536228..3539376 | + | 3149 | Protein_3456 | efflux RND transporter permease AcrB | - |
PQQ10_RS17660 (3539872) | 3539872..3540246 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ10_RS17665 (3540274) | 3540274..3540492 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ10_RS17670 (3540671) | 3540671..3541222 | + | 552 | WP_001278787.1 | maltose O-acetyltransferase | - |
PQQ10_RS17675 (3541340) | 3541340..3541810 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PQQ10_RS17680 (3541866) | 3541866..3542006 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ10_RS17685 (3542012) | 3542012..3542272 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ10_RS17690 (3542497) | 3542497..3544047 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
PQQ10_RS17700 (3544278) | 3544278..3544667 | + | 390 | WP_000961287.1 | MGMT family protein | - |
PQQ10_RS17705 (3544700) | 3544700..3545269 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270726 WP_001280991.1 NZ_CP117351:3540274-3540492 [Salmonella enterica subsp. enterica serovar Dublin]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270726 WP_000344807.1 NZ_CP117351:3539872-3540246 [Salmonella enterica subsp. enterica serovar Dublin]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|