Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3455980..3456600 | Replicon | chromosome |
Accession | NZ_CP117348 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg strain RM101 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PQQ11_RS16995 | Protein ID | WP_001280991.1 |
Coordinates | 3456382..3456600 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PQQ11_RS16990 | Protein ID | WP_000344807.1 |
Coordinates | 3455980..3456354 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ11_RS16980 (3451120) | 3451120..3452313 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PQQ11_RS16985 (3452336) | 3452336..3455484 | + | 3149 | Protein_3319 | efflux RND transporter permease AcrB | - |
PQQ11_RS16990 (3455980) | 3455980..3456354 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PQQ11_RS16995 (3456382) | 3456382..3456600 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PQQ11_RS17000 (3456779) | 3456779..3457330 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PQQ11_RS17005 (3457447) | 3457447..3457917 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PQQ11_RS17010 (3457973) | 3457973..3458113 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PQQ11_RS17015 (3458119) | 3458119..3458379 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PQQ11_RS17020 (3458604) | 3458604..3460154 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
PQQ11_RS17030 (3460385) | 3460385..3460774 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PQQ11_RS17035 (3460807) | 3460807..3461376 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T270704 WP_001280991.1 NZ_CP117348:3456382-3456600 [Salmonella enterica subsp. enterica serovar Heidelberg]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT270704 WP_000344807.1 NZ_CP117348:3455980-3456354 [Salmonella enterica subsp. enterica serovar Heidelberg]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|