Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2402946..2403468 | Replicon | chromosome |
Accession | NZ_CP117348 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg strain RM101 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | A0A5V5H0Y9 |
Locus tag | PQQ11_RS11675 | Protein ID | WP_000221348.1 |
Coordinates | 2403184..2403468 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | PQQ11_RS11670 | Protein ID | WP_000885424.1 |
Coordinates | 2402946..2403194 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ11_RS11645 (2398655) | 2398655..2399563 | - | 909 | WP_274897865.1 | LysR family transcriptional regulator | - |
PQQ11_RS11650 (2400429) | 2400429..2401143 | + | 715 | Protein_2278 | helix-turn-helix domain-containing protein | - |
PQQ11_RS11655 (2401199) | 2401199..2402106 | - | 908 | Protein_2279 | hypothetical protein | - |
PQQ11_RS11660 (2402257) | 2402257..2402589 | - | 333 | WP_000253097.1 | DUF1493 family protein | - |
PQQ11_RS11665 (2402579) | 2402579..2402794 | - | 216 | WP_000206207.1 | hypothetical protein | - |
PQQ11_RS11670 (2402946) | 2402946..2403194 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PQQ11_RS11675 (2403184) | 2403184..2403468 | + | 285 | WP_000221348.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PQQ11_RS11680 (2403639) | 2403639..2404028 | + | 390 | WP_001531585.1 | RidA family protein | - |
PQQ11_RS11685 (2404086) | 2404086..2405159 | - | 1074 | WP_000954686.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
PQQ11_RS11690 (2405352) | 2405352..2405840 | - | 489 | WP_001293629.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
PQQ11_RS11695 (2405885) | 2405885..2407393 | + | 1509 | WP_000214838.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2396509..2410250 | 13741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11093.88 Da Isoelectric Point: 10.6500
>T270703 WP_000221348.1 NZ_CP117348:2403184-2403468 [Salmonella enterica subsp. enterica serovar Heidelberg]
MTYKLAFNESALKEWKKMGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKMGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5V5H0Y9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |