Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 847807..848467 | Replicon | chromosome |
Accession | NZ_CP117348 | ||
Organism | Salmonella enterica subsp. enterica serovar Heidelberg strain RM101 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A5V1QI13 |
Locus tag | PQQ11_RS04130 | Protein ID | WP_000244754.1 |
Coordinates | 848054..848467 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | PQQ11_RS04125 | Protein ID | WP_000351186.1 |
Coordinates | 847807..848073 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ11_RS04105 (843735) | 843735..845168 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
PQQ11_RS04110 (845327) | 845327..845638 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
PQQ11_RS04115 (845802) | 845802..846461 | + | 660 | WP_000250288.1 | hemolysin III family protein | - |
PQQ11_RS04120 (846577) | 846577..847557 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
PQQ11_RS04125 (847807) | 847807..848073 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
PQQ11_RS04130 (848054) | 848054..848467 | + | 414 | WP_000244754.1 | protein YgfX | Toxin |
PQQ11_RS04135 (848520) | 848520..849041 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
PQQ11_RS04140 (849154) | 849154..850050 | + | 897 | WP_000434301.1 | site-specific tyrosine recombinase XerD | - |
PQQ11_RS04145 (850074) | 850074..850787 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PQQ11_RS04150 (850793) | 850793..852526 | + | 1734 | WP_274898091.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16197.18 Da Isoelectric Point: 10.7537
>T270697 WP_000244754.1 NZ_CP117348:848054-848467 [Salmonella enterica subsp. enterica serovar Heidelberg]
VVLWQSDLRVSWRAQWISLLIHGLIAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLIAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT270697 WP_000351186.1 NZ_CP117348:847807-848073 [Salmonella enterica subsp. enterica serovar Heidelberg]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5V1QI13 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |