Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 111188..111843 Replicon plasmid pRM104_1
Accession NZ_CP117347
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM104

Toxin (Protein)


Gene name vagD Uniprot ID M7RF18
Locus tag PQP85_RS24450 Protein ID WP_000812999.1
Coordinates 111188..111616 (-) Length 143 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID H9AC95
Locus tag PQP85_RS24455 Protein ID WP_001261283.1
Coordinates 111613..111843 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP85_RS24415 (PQP85_24415) 106589..107353 + 765 WP_000827659.1 K88 minor fimbrial subunit faeI -
PQP85_RS24420 (PQP85_24420) 107340..107615 + 276 WP_001020576.1 hypothetical protein -
PQP85_RS24425 (PQP85_24425) 107615..108328 + 714 WP_000801115.1 hypothetical protein -
PQP85_RS24430 (PQP85_24430) 108453..109037 + 585 WP_001575501.1 hypothetical protein -
PQP85_RS24435 (PQP85_24435) 109110..109322 + 213 WP_000063794.1 FaeA/PapI family transcriptional regulator -
PQP85_RS24440 (PQP85_24440) 109583..109744 + 162 WP_001816720.1 hypothetical protein -
PQP85_RS24445 (PQP85_24445) 109770..110618 + 849 WP_000175391.1 SdiA-regulated domain-containing protein -
PQP85_RS24450 (PQP85_24450) 111188..111616 - 429 WP_000812999.1 type II toxin-antitoxin system VapC family toxin Toxin
PQP85_RS24455 (PQP85_24455) 111613..111843 - 231 WP_001261283.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PQP85_RS24460 (PQP85_24460) 112588..112806 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA -
PQP85_RS24465 (PQP85_24465) 112808..113113 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB -
PQP85_RS24470 (PQP85_24470) 113115..113405 + 291 WP_001266176.1 hypothetical protein -
PQP85_RS24475 (PQP85_24475) 113402..113923 + 522 WP_000198608.1 hypothetical protein -
PQP85_RS24480 (PQP85_24480) 113958..114740 + 783 WP_000082169.1 site-specific integrase -
PQP85_RS24485 (PQP85_24485) 114749..115432 + 684 WP_001751692.1 EAL domain-containing protein -
PQP85_RS24490 (PQP85_24490) 115486..115974 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
PQP85_RS24495 (PQP85_24495) 115968..116304 + 337 Protein_148 hypothetical protein -
PQP85_RS24500 (PQP85_24500) 116295..116636 + 342 Protein_149 LysM peptidoglycan-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aph(3')-Ia / blaCMY-2 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR faeH / faeI / fdeC / spvC / spvB 1..178387 178387


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(9-133)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 143 a.a.        Molecular weight: 15483.03 Da        Isoelectric Point: 7.6736

>T270692 WP_000812999.1 NZ_CP117347:c111616-111188 [Salmonella enterica subsp. enterica serovar Dublin]
MKQPRTKTYMLDTCICSFIMREQSEAVLKRLEQAVLRGHRIVISAITYSEMRFGATGPKASPRLVQLVDAFCARLDAILP
WDRAAVDATTEIKVALCLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVS

Download         Length: 429 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8737.83 Da        Isoelectric Point: 4.3775

>AT270692 WP_001261283.1 NZ_CP117347:c111843-111613 [Salmonella enterica subsp. enterica serovar Dublin]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB M7RF18

Antitoxin

Source ID Structure
AlphaFold DB A0A6X6R7C5

References