Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 65665..66187 Replicon plasmid pRM104_1
Accession NZ_CP117347
Organism Salmonella enterica subsp. enterica serovar Dublin strain RM104

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag PQP85_RS24165 Protein ID WP_000220560.1
Coordinates 65906..66187 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PQP85_RS24160 Protein ID WP_000121743.1
Coordinates 65665..65916 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PQP85_RS24135 (PQP85_24135) 61076..61696 + 621 WP_000864788.1 ParA family protein -
PQP85_RS24140 (PQP85_24140) 61748..61978 + 231 WP_000051066.1 plasmid partition protein ParG -
PQP85_RS24145 (PQP85_24145) 62617..62970 - 354 WP_001675596.1 DNA distortion polypeptide 3 -
PQP85_RS24150 (PQP85_24150) 63107..63553 - 447 WP_001074381.1 hypothetical protein -
PQP85_RS24155 (PQP85_24155) 63593..64429 - 837 WP_001575533.1 replication initiation protein -
PQP85_RS24160 (PQP85_24160) 65665..65916 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PQP85_RS24165 (PQP85_24165) 65906..66187 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PQP85_RS24170 (PQP85_24170) 66333..66656 + 324 WP_001181909.1 hypothetical protein -
PQP85_RS24175 (PQP85_24175) 66701..66946 + 246 WP_000356542.1 hypothetical protein -
PQP85_RS24180 (PQP85_24180) 66936..67151 + 216 WP_001180117.1 hypothetical protein -
PQP85_RS24185 (PQP85_24185) 67244..67573 + 330 WP_000866650.1 hypothetical protein -
PQP85_RS24190 (PQP85_24190) 67616..67795 + 180 WP_001575529.1 hypothetical protein -
PQP85_RS24195 (PQP85_24195) 67865..68014 + 150 WP_000003880.1 hypothetical protein -
PQP85_RS24200 (PQP85_24200) 68027..68299 + 273 WP_000160399.1 hypothetical protein -
PQP85_RS24205 (PQP85_24205) 68625..69170 + 546 WP_000757691.1 DNA distortion polypeptide 1 -
PQP85_RS24210 (PQP85_24210) 69173..70354 + 1182 WP_000539536.1 MobP1 family relaxase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aph(3')-Ia / blaCMY-2 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR faeH / faeI / fdeC / spvC / spvB 1..178387 178387


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T270691 WP_000220560.1 NZ_CP117347:65906-66187 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT270691 WP_000121743.1 NZ_CP117347:65665-65916 [Salmonella enterica subsp. enterica serovar Dublin]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References