Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4239582..4240098 | Replicon | chromosome |
| Accession | NZ_CP117346 | ||
| Organism | Salmonella enterica subsp. enterica serovar Dublin strain RM104 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | M7RIY5 |
| Locus tag | PQP85_RS20900 | Protein ID | WP_000220574.1 |
| Coordinates | 4239582..4239866 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PQP85_RS20905 | Protein ID | WP_000212724.1 |
| Coordinates | 4239856..4240098 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PQP85_RS20885 (4234698) | 4234698..4236350 | + | 1653 | WP_001751520.1 | alpha,alpha-phosphotrehalase | - |
| PQP85_RS20890 (4236759) | 4236759..4238897 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PQP85_RS20895 (4239114) | 4239114..4239578 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PQP85_RS20900 (4239582) | 4239582..4239866 | - | 285 | WP_000220574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PQP85_RS20905 (4239856) | 4239856..4240098 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PQP85_RS20910 (4240176) | 4240176..4242089 | - | 1914 | WP_001212138.1 | PRD domain-containing protein | - |
| PQP85_RS20915 (4242106) | 4242106..4242846 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| PQP85_RS20920 (4242843) | 4242843..4243961 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PQP85_RS20925 (4243945) | 4243945..4245078 | - | 1134 | WP_000459958.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10869.68 Da Isoelectric Point: 9.8739
>T270687 WP_000220574.1 NZ_CP117346:c4239866-4239582 [Salmonella enterica subsp. enterica serovar Dublin]
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQIKKKLADVLLDPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M7RIY5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |